| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Adenosine receptor A1 |
|---|
| Ligand | BDBM50389797 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_834569 (CHEMBL2072277) |
|---|
| Ki | 6.4±n/a nM |
|---|
| Citation |  Tosh, DK; Phan, K; Gao, ZG; Gakh, AA; Xu, F; Deflorian, F; Abagyan, R; Stevens, RC; Jacobson, KA; Katritch, V Optimization of adenosine 5'-carboxamide derivatives as adenosine receptor agonists using structure-based ligand design and fragment screening. J Med Chem55:4297-308 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Adenosine receptor A1 |
|---|
| Name: | Adenosine receptor A1 |
|---|
| Synonyms: | AA1R_RAT | ADENOSINE A1 | ADENOSINE A1 high | ADENOSINE A1 low | Adenosine A1 receptor (A1) | Adenosine receptor | Adenosine receptors A1 | Adora1 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 36704.13 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | n/a |
|---|
| Residue: | 326 |
|---|
| Sequence: | MPPYISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKTVVT
QRRAAVAIAGCWILSLVVGLTPMFGWNNLSVVEQDWRANGSVGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPTCQKPSILIYIAIFLTHGNSAMNPIVYAFRIHKFRVTFL
KIWNDHFRCQPKPPIDEDLPEEKAED
|
|
|
|---|
| BDBM50389797 |
|---|
| n/a |
|---|
| Name | BDBM50389797 |
|---|
| Synonyms: | CHEMBL261482 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C13H16N6O4 |
|---|
| Mol. Mass. | 320.3039 |
|---|
| SMILES | Nc1ncnc2n(cnc12)[C@@H]1O[C@@H]([C@@H](O)[C@H]1O)C(=O)NC1CC1 |
|---|
| Structure | 
|
|---|
Search and Browse
