| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cathepsin S |
|---|
| Ligand | BDBM50390390 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_834957 (CHEMBL2073367) |
|---|
| IC50 | 1584.89±n/a nM |
|---|
| Citation |  Dossetter, AG; Bowyer, J; Cook, CR; Crawford, JJ; Finlayson, JE; Heron, NM; Heyes, C; Highton, AJ; Hudson, JA; Jestel, A; Krapp, S; MacFaul, PA; McGuire, TM; Morley, AD; Morris, JJ; Page, KM; Ribeiro, LR; Sawney, H; Steinbacher, S; Smith, C Isosteric replacements for benzothiazoles and optimisation to potent Cathepsin K inhibitors free from hERG channel inhibition. Bioorg Med Chem Lett22:5563-8 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cathepsin S |
|---|
| Name: | Cathepsin S |
|---|
| Synonyms: | CATS_HUMAN | CTSS | Cathepsin S (Cat S) | cathepsin S preproprotein |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 37507.38 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P25774 |
|---|
| Residue: | 331 |
|---|
| Sequence: | MKRLVCVLLVCSSAVAQLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVM
LHNLEHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNRILPDSVD
WREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGC
NGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKE
AVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSW
GHNFGEEGYIRMARNKGNHCGIASFPSYPEI
|
|
|
|---|
| BDBM50390390 |
|---|
| n/a |
|---|
| Name | BDBM50390390 |
|---|
| Synonyms: | CHEMBL2070938 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H25N5O2S |
|---|
| Mol. Mass. | 387.499 |
|---|
| SMILES | O=C(NC1(CC1)C#N)[C@@H]1CCCC[C@H]1C(=O)N1CCN(CC1)c1nccs1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
