Reaction Details |
| Report a problem with these data |
Target | Serine/threonine-protein kinase pim-1 |
---|
Ligand | BDBM50391936 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_849985 (CHEMBL2149642) |
---|
IC50 | 410±n/a nM |
---|
Citation | Nakano, H; Saito, N; Parker, L; Tada, Y; Abe, M; Tsuganezawa, K; Yokoyama, S; Tanaka, A; Kojima, H; Okabe, T; Nagano, T Rational evolution of a novel type of potent and selective proviral integration site in Moloney murine leukemia virus kinase 1 (PIM1) inhibitor from a screening-hit compound. J Med Chem55:5151-64 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Serine/threonine-protein kinase pim-1 |
---|
Name: | Serine/threonine-protein kinase pim-1 |
Synonyms: | PIM-1 Kinase | PIM1 | PIM1_HUMAN | Proto-oncogene serine/threonine-protein kinase Pim-1 | Serine/threonine-protein kinase (PIM1) | Serine/threonine-protein kinase PIM | Serine/threonine-protein kinase PIM1 | Serine/threonine-protein kinase pim-1 (PIM1) |
Type: | Protein |
Mol. Mass.: | 35681.82 |
Organism: | Homo sapiens (Human) |
Description: | P11309 |
Residue: | 313 |
Sequence: | MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSD
NLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRG
ELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETA
EIHLHSLSPGPSK
|
|
|
BDBM50391936 |
---|
n/a |
---|
Name | BDBM50391936 |
Synonyms: | CHEMBL2147758 |
Type | Small organic molecule |
Emp. Form. | C24H24N2O3 |
Mol. Mass. | 388.459 |
SMILES | Oc1ccc2C(=O)\C(Oc2c1CN1CCCCCC1)=C\c1c[nH]c2ccccc12 |
Structure |
|