Reaction Details |
| Report a problem with these data |
Target | Hypoxanthine-guanine phosphoribosyltransferase |
---|
Ligand | BDBM50392250 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_850551 (CHEMBL2157773) |
---|
Ki | 35000±n/a nM |
---|
Citation | Hocková, D; Keough, DT; Janeba, Z; Wang, TH; de Jersey, J; Guddat, LW Synthesis of novel N-branched acyclic nucleoside phosphonates as potent and selective inhibitors of human, Plasmodium falciparum and Plasmodium vivax 6-oxopurine phosphoribosyltransferases. J Med Chem55:6209-23 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Hypoxanthine-guanine phosphoribosyltransferase |
---|
Name: | Hypoxanthine-guanine phosphoribosyltransferase |
Synonyms: | HGPRT | HGPRTase | HPRT | HPRT1 | HPRT_HUMAN | Hypoxanthine-guanine phosphoribosyltransferase | Hypoxanthine-guanine phosphoribosyltransferase (HGPRT) |
Type: | Protein |
Mol. Mass.: | 24579.61 |
Organism: | Homo sapiens (Human) |
Description: | P00492 |
Residue: | 218 |
Sequence: | MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGH
HIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGD
DLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVG
FEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
|
|
|
BDBM50392250 |
---|
n/a |
---|
Name | BDBM50392250 |
Synonyms: | CHEMBL2153489 |
Type | Small organic molecule |
Emp. Form. | C11H15N6O4P |
Mol. Mass. | 326.2484 |
SMILES | OP(O)(=O)CCN(CCn1cnc2c1nc[nH]c2=O)CC#N |
Structure |
|