| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mitogen-activated protein kinase 1 |
|---|
| Ligand | BDBM50392851 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_853360 (CHEMBL2155150) |
|---|
| IC50 | 4600±n/a nM |
|---|
| Citation |  Kaoud, TS; Yan, C; Mitra, S; Tseng, CC; Jose, J; Taliaferro, JM; Tuohetahuntila, M; Devkota, A; Sammons, R; Park, J; Park, H; Shi, Y; Hong, J; Ren, P; Dalby, KN From in Silico Discovery to intra-Cellular Activity: Targeting JNK-Protein Interactions with Small Molecules. ACS Med Chem Lett3:721-725 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mitogen-activated protein kinase 1 |
|---|
| Name: | Mitogen-activated protein kinase 1 |
|---|
| Synonyms: | ERK-2 | ERT1 | Erk2 | Extracellular signal-regulated kinase 2 | MAP kinase 2 | MAPK 2 | MK01_RAT | Mapk | Mapk1 | Mitogen-activated protein kinase 2 | Prkm1 | p42-MAPK |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 41278.65 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | MAP Kinase is the rat ERK-2 isoform containing a polyhistidine tag at the N-terminus produced in
E.coli. and activated by phosphorylation with MEK1 prior to purification. |
|---|
| Residue: | 358 |
|---|
| Sequence: | MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQ
TYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLS
NDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTG
FLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILG
ILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRI
EVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
|
|
|
|---|
| BDBM50392851 |
|---|
| n/a |
|---|
| Name | BDBM50392851 |
|---|
| Synonyms: | CHEMBL2151192 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C13H13BrN10 |
|---|
| Mol. Mass. | 389.213 |
|---|
| SMILES | Nc1[nH]n2c(nc(N)c3c(N)nnc23)c1NNc1ccc(Br)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
