Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMethionyl-tRNA synthetase
LigandBDBM50393798
Substrate/Competitorn/a
Meas. Tech.ChEMBL_854755
IC50 3720±n/a nM
Citation Shibata SGillespie JRRanade RMKoh CYKim JELaydbak JUZucker FHHol WGVerlinde CLBuckner FSFan E Urea-based inhibitors of Trypanosoma brucei methionyl-tRNA synthetase: selectivity and in vivo characterization. J Med Chem 55:6342-51 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Methionyl-tRNA synthetase
Name:Methionyl-tRNA synthetase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:101110.04
Organism:Homo sapiens (Human)
Description:ChEMBL_105283
Residue:900
Sequence:
MRLFVSDGVPGCLPVLAAAGRARGRAEVLISTVGPEDCVVPFLTRPKVPVLQLDSGNYLF
STSAICRYFFLLSGWEQDDLTNQWLEWEATELQPALSAALYYLVVQGKKGEDVLGSVRRA
LTHIDHSLSRQNCPFLAGETESLADIVLWGALYPLLQDPAYLPEELSALHSWFQTLSTQE
PCQRAAETVLKQQGVLALRPYLQKQPQPSPAEGRAVTNEPEEEELATLSEEEIAMAVTAW
EKGLESLPPLRPQQNPVLPVAGERNVLITSALPYVNNVPHLGNIIGCVLSADVFARYSRL
RQWNTLYLCGTDEYGTATETKALEEGLTPQEICDKYHIIHADIYRWFNISFDIFGRTTTP
QQTKITQDIFQQLLKRGFVLQDTVEQLRCEHCARFLADRFVEGVCPFCGYEEARGDQCDK
CGKLINAVELKKPQCKVCRSCPVVQSSQHLFLDLPKLEKRLEEWLGRTLPGSDWTPNAQF
ITRSWLRDGLKPRCITRDLKWGTPVPLEGFEDKVFYVWFDATIGYLSITANYTDQWERWW
KNPEQVDLYQFMAKDNVPFHSLVFPCSALGAEDNYTLVSHLIATEYLNYEDGKFSKSRGV
GVFGDMAQDTGIPADIWRFYLLYIRPEGQDSAFSWTDLLLKNNSELLNNLGNFINRAGMF
VSKFFGGYVPEMVLTPDDQRLLAHVTLELQHYHQLLEKVRIRDALRSILTISRHGNQYIQ
VNEPWKRIKGSEADRQRAGTVTGLAVNIAALLSVMLQPYMPTVSATIQAQLQLPPPACSI
LLTNFLCTLPAGHQIGTVSPLFQKLENDQIESLRQRFGGGQAKTSPKPAVVETVTTAKPQ
QIQALMDEVTKQGNIVRELKAQKADKNEVAAEVAKLLDLKKQLAVAEGKPPEAPKGKKKK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50393798
n/a
NameBDBM50393798
Synonyms:CHEMBL2159525
TypeSmall organic molecule
Emp. Form.C17H19Cl2N3O2
Mol. Mass.368.258
SMILESOc1ccccc1NC(=O)NCCCNCc1cc(Cl)cc(Cl)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: