Reaction Details |
| Report a problem with these data |
Target | HTH-type transcriptional regulator EthR |
---|
Ligand | BDBM50395181 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_859797 (CHEMBL2169625) |
---|
EC50 | >10000±n/a nM |
---|
Citation | Flipo, M; Willand, N; Lecat-Guillet, N; Hounsou, C; Desroses, M; Leroux, F; Lens, Z; Villeret, V; Wohlkönig, A; Wintjens, R; Christophe, T; Kyoung Jeon, H; Locht, C; Brodin, P; Baulard, AR; Déprez, B Discovery of novel N-phenylphenoxyacetamide derivatives as EthR inhibitors and ethionamide boosters by combining high-throughput screening and synthesis. J Med Chem55:6391-402 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
HTH-type transcriptional regulator EthR |
---|
Name: | HTH-type transcriptional regulator EthR |
Synonyms: | ETHR_MYCTU | HTH-type transcriptional regulator EthR | Transcriptional repressor EthR (EthR) | etaR | ethR |
Type: | Protein |
Mol. Mass.: | 23751.94 |
Organism: | Mycobacterium tuberculosis |
Description: | P9WMC1 |
Residue: | 216 |
Sequence: | MTTSAASQASLPRGRRTARPSGDDRELAILATAENLLEDRPLADISVDDLAKGAGISRPT
FYFYFPSKEAVLLTLLDRVVNQADMALQTLAENPADTDRENMWRTGINVFFETFGSHKAV
TRAGQAARATSVEVAELWSTFMQKWIAYTAAVIDAERDRGAAPRTLPAHELATALNLMNE
RTLFASFAGEQPSVPEARVLDTLVHIWVTSIYGENR
|
|
|
BDBM50395181 |
---|
n/a |
---|
Name | BDBM50395181 |
Synonyms: | CHEMBL2164306 |
Type | Small organic molecule |
Emp. Form. | C22H18N2O2S2 |
Mol. Mass. | 406.521 |
SMILES | COc1cccc(SCC(=O)Nc2ccc(cc2)-c2nc3ccccc3s2)c1 |
Structure |
|