| Reaction Details |
|---|
 | Report a problem with these data |
| Target | HTH-type transcriptional regulator EthR |
|---|
| Ligand | BDBM50395185 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_859797 (CHEMBL2169625) |
|---|
| EC50 | 210±n/a nM |
|---|
| Citation |  Flipo, M; Willand, N; Lecat-Guillet, N; Hounsou, C; Desroses, M; Leroux, F; Lens, Z; Villeret, V; Wohlkönig, A; Wintjens, R; Christophe, T; Kyoung Jeon, H; Locht, C; Brodin, P; Baulard, AR; Déprez, B Discovery of novel N-phenylphenoxyacetamide derivatives as EthR inhibitors and ethionamide boosters by combining high-throughput screening and synthesis. J Med Chem55:6391-402 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| HTH-type transcriptional regulator EthR |
|---|
| Name: | HTH-type transcriptional regulator EthR |
|---|
| Synonyms: | ETHR_MYCTU | HTH-type transcriptional regulator EthR | Transcriptional repressor EthR (EthR) | etaR | ethR |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 23751.94 |
|---|
| Organism: | Mycobacterium tuberculosis |
|---|
| Description: | P9WMC1 |
|---|
| Residue: | 216 |
|---|
| Sequence: | MTTSAASQASLPRGRRTARPSGDDRELAILATAENLLEDRPLADISVDDLAKGAGISRPT
FYFYFPSKEAVLLTLLDRVVNQADMALQTLAENPADTDRENMWRTGINVFFETFGSHKAV
TRAGQAARATSVEVAELWSTFMQKWIAYTAAVIDAERDRGAAPRTLPAHELATALNLMNE
RTLFASFAGEQPSVPEARVLDTLVHIWVTSIYGENR
|
|
|
|---|
| BDBM50395185 |
|---|
| n/a |
|---|
| Name | BDBM50395185 |
|---|
| Synonyms: | CHEMBL2164318 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H18N2O3S |
|---|
| Mol. Mass. | 390.455 |
|---|
| SMILES | COc1cccc(OCC(=O)Nc2ccc(cc2)-c2nc3ccccc3s2)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
