| Reaction Details |
|---|
 | Report a problem with these data |
| Target | HTH-type transcriptional regulator EthR |
|---|
| Ligand | BDBM50395186 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_859798 (CHEMBL2169626) |
|---|
| IC50 | 2900±n/a nM |
|---|
| Citation |  Flipo, M; Willand, N; Lecat-Guillet, N; Hounsou, C; Desroses, M; Leroux, F; Lens, Z; Villeret, V; Wohlkönig, A; Wintjens, R; Christophe, T; Kyoung Jeon, H; Locht, C; Brodin, P; Baulard, AR; Déprez, B Discovery of novel N-phenylphenoxyacetamide derivatives as EthR inhibitors and ethionamide boosters by combining high-throughput screening and synthesis. J Med Chem55:6391-402 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| HTH-type transcriptional regulator EthR |
|---|
| Name: | HTH-type transcriptional regulator EthR |
|---|
| Synonyms: | ETHR_MYCS2 | MSMEI_6273 | ethR |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 23512.52 |
|---|
| Organism: | Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) |
|---|
| Description: | ChEMBL_859798 |
|---|
| Residue: | 217 |
|---|
| Sequence: | MTTASQTRTPRGRRSARPSGDDREAAILATAQRLLETKKFAEISVDDLAKGAGISRPTFY
FYFPSKEAVLLSLIDPLIKRADSGFDNAVESMPADPQRAIRRGIEIFFNSFGSHPATARA
GTEALKSSPEFKEFWSGLMQKWIAATAALITAERERGAAPDTIPALDLATSLNLMNERTM
MAALADEQPGVAPEKVVATLTHIWLNSIYGTLPVGTA
|
|
|
|---|
| BDBM50395186 |
|---|
| n/a |
|---|
| Name | BDBM50395186 |
|---|
| Synonyms: | CHEMBL1612418 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H20N4O2 |
|---|
| Mol. Mass. | 372.4198 |
|---|
| SMILES | Cc1ccc(cc1)-n1nc2ccc(NC(=O)COc3ccccc3C)cc2n1 |
|---|
| Structure | 
|
|---|
Search and Browse
