| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Apoptosis regulator Bcl-2 |
|---|
| Ligand | BDBM50397471 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_862011 (CHEMBL2173961) |
|---|
| Ki | 207±n/a nM |
|---|
| Citation |  Chen, J; Zhou, H; Aguilar, A; Liu, L; Bai, L; McEachern, D; Yang, CY; Meagher, JL; Stuckey, JA; Wang, S Structure-based discovery of BM-957 as a potent small-molecule inhibitor of Bcl-2 and Bcl-xL capable of achieving complete tumor regression. J Med Chem55:8502-14 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Apoptosis regulator Bcl-2 |
|---|
| Name: | Apoptosis regulator Bcl-2 |
|---|
| Synonyms: | Apoptosis regulator Bcl-2 Protein | B-cell lymphoma 2 protein (Bcl-2) | BCL-2 | BCL2 | BCL2_HUMAN | Bcl-2 Protein |
|---|
| Type: | Homodimer or heterodimer |
|---|
| Mol. Mass.: | 26269.11 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P10415 |
|---|
| Residue: | 239 |
|---|
| Sequence: | MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
|
|
|
|---|
| BDBM50397471 |
|---|
| n/a |
|---|
| Name | BDBM50397471 |
|---|
| Synonyms: | CHEMBL2169898 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C44H52ClN7O4S |
|---|
| Mol. Mass. | 810.446 |
|---|
| SMILES | COc1cccc(c1)S(=O)(=O)Nc1ccc(cc1)N1CCN(CC1)c1cccc(c1)-c1c(C(=O)NCCCN2CCN(C)CC2)c(C)n(C)c1-c1ccc(Cl)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
