| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI |
|---|
| Ligand | BDBM50399402 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_877886 (CHEMBL2188143) |
|---|
| IC50 | 56±n/a nM |
|---|
| Citation |  Gerusz, V; Denis, A; Faivre, F; Bonvin, Y; Oxoby, M; Briet, S; LeFralliec, G; Oliveira, C; Desroy, N; Raymond, C; Peltier, L; Moreau, F; Escaich, S; Vongsouthi, V; Floquet, S; Drocourt, E; Walton, A; Prouvensier, L; Saccomani, M; Durant, L; Genevard, JM; Sam-Sambo, V; Soulama-Mouze, C From triclosan toward the clinic: discovery of nonbiocidal, potent FabI inhibitors for the treatment of resistant bacteria. J Med Chem55:9914-28 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI |
|---|
| Name: | Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI |
|---|
| Synonyms: | Enoyl-ACP Reductase (FabI) | Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI | FABI_STAAR | NADPH-dependent enoyl-ACP reductase | fabI | trans-2-enoyl-[acyl carrier protein] reductase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 27989.00 |
|---|
| Organism: | Staphylococcus aureus |
|---|
| Description: | Q6GI75 |
|---|
| Residue: | 256 |
|---|
| Sequence: | MLNLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLLEQLNQPEA
HLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDLRGRFSETSREGFLLAQDI
SSYSLTIVAHEAKKLMPEGGSIVATTYLGGEFAVQNYNVMGVAKASLEANVKYLALDLGP
DNIRVNAISAGPIRTLSAKGVGGFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSG
VTGENIHVDSGFHAIK
|
|
|
|---|
| BDBM50399402 |
|---|
| n/a |
|---|
| Name | BDBM50399402 |
|---|
| Synonyms: | CHEMBL2178289 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C13H13FN2O2 |
|---|
| Mol. Mass. | 248.2529 |
|---|
| SMILES | CCc1cc(O)c(Oc2cccnc2N)cc1F |
|---|
| Structure | 
|
|---|
Search and Browse
