Reaction Details |
| Report a problem with these data |
Target | 5-hydroxytryptamine receptor 4 |
---|
Ligand | BDBM50399616 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_878537 (CHEMBL2188202) |
---|
Ki | 5±n/a nM |
---|
Citation | Dubost, E; Dumas, N; Fossey, C; Magnelli, R; Butt-Gueulle, S; Ballandonne, C; Caignard, DH; Dulin, F; Sopkova de-Oliveira Santos, J; Millet, P; Charnay, Y; Rault, S; Cailly, T; Fabis, F Synthesis and structure-affinity relationships of selective high-affinity 5-HT(4) receptor antagonists: application to the design of new potential single photon emission computed tomography tracers. J Med Chem55:9693-707 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
5-hydroxytryptamine receptor 4 |
---|
Name: | 5-hydroxytryptamine receptor 4 |
Synonyms: | 5-HT-4 | 5-HT4 | 5-HT4S | 5-HT4a | 5-HT4b | 5-HT4c | 5-HT4d | 5-HT4hb | 5-hydroxytryptamine receptor 4 | 5-hydroxytryptamine receptor 4 (5-HT4) | 5HT4R_HUMAN | HTR4 | Serotonin (5-HT) receptor | Serotonin (5-HT3) receptor | Serotonin 4 (5-HT4) receptor | Serotonin Receptor 4 |
Type: | Enzyme |
Mol. Mass.: | 43767.54 |
Organism: | Homo sapiens (Human) |
Description: | Q13639 |
Residue: | 388 |
Sequence: | MDKLDANVSSEEGFGSVEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIV
SLAFADLLVSVLVMPFGAIELVQDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYY
AICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSN
STYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSESRP
QSADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQVWTAFLWL
GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRD
AVECGGQWESQCHPPATSPLVAAQPSDT
|
|
|
BDBM50399616 |
---|
n/a |
---|
Name | BDBM50399616 |
Synonyms: | CHEMBL2181188 |
Type | Small organic molecule |
Emp. Form. | C22H25ClN2O |
Mol. Mass. | 368.9 |
SMILES | CCCN1CCC(COc2nc3c(Cl)cccc3c3ccccc23)CC1 |
Structure |
|