| Reaction Details |
|---|
 | Report a problem with these data |
| Target | NAD-dependent protein deacylase sirtuin-5, mitochondrial |
|---|
| Ligand | BDBM50400733 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_880330 (CHEMBL2209185) |
|---|
| IC50 | 2300±n/a nM |
|---|
| Citation |  Maurer, B; Rumpf, T; Scharfe, M; Stolfa, DA; Schmitt, ML; He, W; Verdin, E; Sippl, W; Jung, M Inhibitors of the NAD(+)-Dependent Protein Desuccinylase and Demalonylase Sirt5. ACS Med Chem Lett3:1050-1053 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| NAD-dependent protein deacylase sirtuin-5, mitochondrial |
|---|
| Name: | NAD-dependent protein deacylase sirtuin-5, mitochondrial |
|---|
| Synonyms: | NAD-dependent protein deacetylase sirtuin-5 (SIRT5) | NAD-dependent protein deacylase sirtuin-5, mitochondrial | Regulatory protein SIR2 homolog 5 | SIR2-like protein 5 | SIR2L5 | SIR5_HUMAN | SIRT5 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 33892.62 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q9NXA8 |
|---|
| Residue: | 310 |
|---|
| Sequence: | MRPLQIVPSRLISQLYCGLKPPASTRNQICLKMARPSSSMADFRKFFAKAKHIVIISGAG
VSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRA
IAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPI
CPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELA
HCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEA
LACHENETVS
|
|
|
|---|
| BDBM50400733 |
|---|
| n/a |
|---|
| Name | BDBM50400733 |
|---|
| Synonyms: | CHEMBL2203548 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H12Cl2N2O3S |
|---|
| Mol. Mass. | 407.27 |
|---|
| SMILES | Clc1cccc(-c2ccc(\C=C3/C(=O)NC(=S)N(CC=C)C3=O)o2)c1Cl |
|---|
| Structure | 
|
|---|
Search and Browse
