| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Thromboxane A2 receptor |
|---|
| Ligand | BDBM50401097 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_884206 (CHEMBL2209436) |
|---|
| IC50 | 560000±n/a nM |
|---|
| Citation |  Kaila, N; Huang, A; Moretto, A; Follows, B; Janz, K; Lowe, M; Thomason, J; Mansour, TS; Hubeau, C; Page, K; Morgan, P; Fish, S; Xu, X; Williams, C; Saiah, E Diazine indole acetic acids as potent, selective, and orally bioavailable antagonists of chemoattractant receptor homologous molecule expressed on Th2 cells (CRTH2) for the treatment of allergic inflammatory diseases. J Med Chem55:5088-109 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Thromboxane A2 receptor |
|---|
| Name: | Thromboxane A2 receptor |
|---|
| Synonyms: | Prostanoid TP receptor | TA2R_HUMAN | TBXA2R | TXA2-R | Thromboxane | Thromboxane A2 receptor | Thromboxane Beta |
|---|
| Type: | Enyzme |
|---|
| Mol. Mass.: | 37445.28 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P21731 |
|---|
| Residue: | 343 |
|---|
| Sequence: | MWPNGSSLGPCFRPTNITLEERRLIASPWFAASFCVVGLASNLLALSVLAGARQGGSHTR
SSFLTFLCGLVLTDFLGLLVTGTIVVSQHAALFEWHAVDPGCRLCRFMGVVMIFFGLSPL
LLGAAMASERYLGITRPFSRPAVASQRRAWATVGLVWAAALALGLLPLLGVGRYTVQYPG
SWCFLTLGAESGDVAFGLLFSMLGGLSVGLSFLLNTVSVATLCHVYHGQEAAQQRPRDSE
VEMMAQLLGIMVVASVCWLPLLVFIAQTVLRNPPAMSPAGQLSRTTEKELLIYLRVATWN
QILDPWVYILFRRAVLRRLQPRLSTRPRSLSLQPQLTQRSGLQ
|
|
|
|---|
| BDBM50401097 |
|---|
| n/a |
|---|
| Name | BDBM50401097 |
|---|
| Synonyms: | CHEMBL2204469 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H18F3N3O3 |
|---|
| Mol. Mass. | 441.4025 |
|---|
| SMILES | Cc1c(Cc2ccc(=O)n(Cc3ccc(F)cc3F)n2)c2cc(F)ccc2n1CC(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
