Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetIndoleamine 2,3-dioxygenase 1
LigandBDBM31772
Substrate/Competitorn/a
Meas. Tech.ChEMBL_885589
IC50 17800±n/a nM
Citation Bakmiwewa SMFatokun AATran APayne RJHunt NHBall HJ Identification of selective inhibitors of indoleamine 2,3-dioxygenase 2. Bioorg Med Chem Lett 22:7641-6 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Indoleamine 2,3-dioxygenase 1
Name:Indoleamine 2,3-dioxygenase 1
Synonyms:IDO-1 | Indoleamine-pyrrole 2,3-dioxygenase
Type:PROTEIN
Mol. Mass.:45639.39
Organism:Mus musculus
Description:ChEMBL_1452149
Residue:407
Sequence:
MALSKISPTEGSRRILEDHHIDEDVGFALPHPLVELPDAYSPWVLVARNLPVLIENGQLR
EEVEKLPTLSTDGLRGHRLQRLAHLALGYITMAYVWNRGDDDVRKVLPRNIAVPYCELSE
KLGLPPILSYADCVLANWKKKDPNGPMTYENMDILFSFPGGDCDKGFFLVSLLVEIAASP
AIKAIPTVSSAVERQDLKALEKALHDIATSLEKAKEIFKRMRDFVDPDTFFHVLRIYLSG
WKCSSKLPEGLLYEGVWDTPKMFSGGSAGQSSIFQSLDVLLGIKHEAGKESPAEFLQEMR
EYMPPAHRNFLFFLESAPPVREFVISRHNEDLTKAYNECVNGLVSVRKFHLAIVDTYIMK
PSKKKPTDGDKSEEPSNVESRGTGGTNPMTFLRSVKDTTEKALLSWP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM31772
n/a
NameBDBM31772
Synonyms:1-[2-(2,4-dichlorobenzyl)oxy-2-(2,4-dichlorophenyl)ethyl]imidazole;nitric acid | Brentan | CHEMBL91 | Dactarin | Miconazole | US9138393, Miconazole Nitrate | US9144538, Miconazole Nitrate | cid_4189
TypeSmall organic molecule
Emp. Form.C18H14Cl4N2O
Mol. Mass.416.129
SMILESClc1ccc(COC(Cn2ccnc2)c2ccc(Cl)cc2Cl)c(Cl)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: