Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetIndoleamine 2,3-dioxygenase 1
LigandBDBM47032
Substrate/Competitorn/a
Meas. Tech.ChEMBL_885589
IC50 94000±n/a nM
Citation Bakmiwewa SMFatokun AATran APayne RJHunt NHBall HJ Identification of selective inhibitors of indoleamine 2,3-dioxygenase 2. Bioorg Med Chem Lett 22:7641-6 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Indoleamine 2,3-dioxygenase 1
Name:Indoleamine 2,3-dioxygenase 1
Synonyms:IDO-1 | Indoleamine-pyrrole 2,3-dioxygenase
Type:PROTEIN
Mol. Mass.:45639.39
Organism:Mus musculus
Description:ChEMBL_1452149
Residue:407
Sequence:
MALSKISPTEGSRRILEDHHIDEDVGFALPHPLVELPDAYSPWVLVARNLPVLIENGQLR
EEVEKLPTLSTDGLRGHRLQRLAHLALGYITMAYVWNRGDDDVRKVLPRNIAVPYCELSE
KLGLPPILSYADCVLANWKKKDPNGPMTYENMDILFSFPGGDCDKGFFLVSLLVEIAASP
AIKAIPTVSSAVERQDLKALEKALHDIATSLEKAKEIFKRMRDFVDPDTFFHVLRIYLSG
WKCSSKLPEGLLYEGVWDTPKMFSGGSAGQSSIFQSLDVLLGIKHEAGKESPAEFLQEMR
EYMPPAHRNFLFFLESAPPVREFVISRHNEDLTKAYNECVNGLVSVRKFHLAIVDTYIMK
PSKKKPTDGDKSEEPSNVESRGTGGTNPMTFLRSVKDTTEKALLSWP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM47032
n/a
NameBDBM47032
Synonyms:2-[[3-methyl-4-(2,2,2-trifluoroethoxy)-2-pyridinyl]methylsulfinyl]-1H-benzimidazole | 2-[[3-methyl-4-(2,2,2-trifluoroethoxy)-2-pyridyl]methylsulfinyl]-1H-benzimidazole | 2-[[3-methyl-4-(2,2,2-trifluoroethoxy)pyridin-2-yl]methylsulfinyl]-1H-benzimidazole | 2-[[3-methyl-4-[2,2,2-tris(fluoranyl)ethoxy]pyridin-2-yl]methylsulfinyl]-1H-benzimidazole | LANSOPRAZOLE | MLS-0003247.0001 | cid_3883
TypeSmall organic molecule
Emp. Form.C16H14F3N3O2S
Mol. Mass.369.361
SMILESCc1c(OCC(F)(F)F)ccnc1CS(=O)c1nc2ccccc2[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: