| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM1223 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_159137 (CHEMBL859312) |
|---|
| Ki | 15.8±n/a nM |
|---|
| Citation |  Kroemer, RT; Ettmayer, P; Hecht, P 3D-quantitative structure-activity relationships of human immunodeficiency virus type-1 proteinase inhibitors: comparative molecular field analysis of 2-heterosubstituted statine derivatives-implications for the design of novel inhibitors. J Med Chem38:4917-28 (1996) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM1223 |
|---|
| n/a |
|---|
| Name | BDBM1223 |
|---|
| Synonyms: | 2-Aminobenzyl-Substituted AHPPA deriv. 41 | benzyl N-[(1S)-1-{[(2S,3R,4R)-3-hydroxy-4-{[(1S,2R)-2-hydroxy-2,3-dihydro-1H-inden-1-yl]carbamoyl}-4-({[4-(2-hydroxyethoxy)phenyl]methyl}amino)-1-phenylbutan-2-yl]carbamoyl}-2,2-dimethylpropyl]carbamate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C43H52N4O8 |
|---|
| Mol. Mass. | 752.895 |
|---|
| SMILES | CC(C)(C)[C@H](NC(=O)OCc1ccccc1)C(=O)N[C@@H](Cc1ccccc1)[C@@H](O)[C@@H](NCc1ccc(OCCO)cc1)C(=O)N[C@@H]1[C@H](O)Cc2ccccc12 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
