Reaction Details |
| Report a problem with these data |
Target | 5-hydroxytryptamine receptor 1D |
---|
Ligand | BDBM50407789 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1953 (CHEMBL617560) |
---|
IC50 | >100000±n/a nM |
---|
Citation | Rault, S; Lancelot, JC; Prunier, H; Robba, M; Renard, P; Delagrange, P; Pfeiffer, B; Caignard, DH; Guardiola-Lemaitre, B; Hamon, M Novel selective and partial agonists of 5-HT3 receptors. Part 1. Synthesis and biological evaluation of piperazinopyrrolothienopyrazines. J Med Chem39:2068-80 (1996) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
5-hydroxytryptamine receptor 1D |
---|
Name: | 5-hydroxytryptamine receptor 1D |
Synonyms: | 5HT1D_PIG | HTR1D | Serotonin 1d (5-HT1d) receptor |
Type: | PROTEIN |
Mol. Mass.: | 32680.56 |
Organism: | Sus scrofa |
Description: | ChEMBL_1963 |
Residue: | 291 |
Sequence: | AMTDLLVSILVMPISIPYTITQTWSFGQLLCDIWLSSDITCCTASILHLCVIALDRYWAI
TDALEYSKRRTAGHAAAMIAIVWAISICISIPPLFWRQARAHEEISDCLVNTSQISYTIY
STCGAFYIPSLLLIILYGRIYRAARNRILNPPSLYGKRFTTAHLITGSAGSSLCSLNPSL
HEGHSHSAGSPLFFNHVKIKLADSVLERKRISAARERKATKTLGIILGAFIICWLPFFVA
SLVLPICRDSCWIHPALFDFFTWLGYLNSLINPIIYTVFNEEFRQAFQKVV
|
|
|
BDBM50407789 |
---|
n/a |
---|
Name | BDBM50407789 |
Synonyms: | CHEMBL52772 |
Type | Small organic molecule |
Emp. Form. | C20H19FN4S |
Mol. Mass. | 366.455 |
SMILES | Fc1ccc(CN2CCN(CC2)c2nc3sccc3n3cccc23)cc1 |
Structure |
|