| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine receptor 1D |
|---|
| Ligand | BDBM50408151 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1952 (CHEMBL617559) |
|---|
| IC50 | 85113.8±n/a nM |
|---|
| Citation |  Prunier, H; Rault, S; Lancelot, JC; Robba, M; Renard, P; Delagrange, P; Pfeiffer, B; Caignard, DH; Misslin, R; Guardiola-Lemaitre, B; Hamon, M Novel and selective partial agonists of 5-HT3 receptors. 2. Synthesis and biological evaluation of piperazinopyridopyrrolopyrazines, piperazinopyrroloquinoxalines, and piperazinopyridopyrroloquinoxalines. J Med Chem40:1808-19 (1997) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 5-hydroxytryptamine receptor 1D |
|---|
| Name: | 5-hydroxytryptamine receptor 1D |
|---|
| Synonyms: | 5HT1D_PIG | HTR1D | Serotonin 1d (5-HT1d) receptor |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 32680.56 |
|---|
| Organism: | Sus scrofa |
|---|
| Description: | ChEMBL_1963 |
|---|
| Residue: | 291 |
|---|
| Sequence: | AMTDLLVSILVMPISIPYTITQTWSFGQLLCDIWLSSDITCCTASILHLCVIALDRYWAI
TDALEYSKRRTAGHAAAMIAIVWAISICISIPPLFWRQARAHEEISDCLVNTSQISYTIY
STCGAFYIPSLLLIILYGRIYRAARNRILNPPSLYGKRFTTAHLITGSAGSSLCSLNPSL
HEGHSHSAGSPLFFNHVKIKLADSVLERKRISAARERKATKTLGIILGAFIICWLPFFVA
SLVLPICRDSCWIHPALFDFFTWLGYLNSLINPIIYTVFNEEFRQAFQKVV
|
|
|
|---|
| BDBM50408151 |
|---|
| n/a |
|---|
| Name | BDBM50408151 |
|---|
| Synonyms: | CHEMBL299524 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H23FN4 |
|---|
| Mol. Mass. | 374.4539 |
|---|
| SMILES | Fc1ccc(CN2CCN(Cc3nc4ccccc4n4cccc34)CC2)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
