| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50410027 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_308167 (CHEMBL834181) |
|---|
| Ki | 2.51±n/a nM |
|---|
| Citation |  Garg, R; Patel, D Hydrophobicity in the design of P2/P2' tetrahydropyrimidinone HIV protease inhibitors. Bioorg Med Chem Lett15:3767-70 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50410027 |
|---|
| n/a |
|---|
| Name | BDBM50410027 |
|---|
| Synonyms: | CHEMBL180816 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C33H34N2O4 |
|---|
| Mol. Mass. | 522.6341 |
|---|
| SMILES | OCc1ccc(cc1)N1[C@H](CCc2ccccc2)[C@@H](O)[C@@H](Cc2ccccc2)N(C1=O)c1ccc(CO)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
