Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50410042 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_308167 (CHEMBL834181) |
---|
Ki | 1.41±n/a nM |
---|
Citation | Garg, R; Patel, D Hydrophobicity in the design of P2/P2' tetrahydropyrimidinone HIV protease inhibitors. Bioorg Med Chem Lett15:3767-70 (2005) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50410042 |
---|
n/a |
---|
Name | BDBM50410042 |
Synonyms: | CHEMBL366431 |
Type | Small organic molecule |
Emp. Form. | C33H30F2N4O4 |
Mol. Mass. | 584.6125 |
SMILES | NC(=O)c1cc(ccc1F)N1[C@H](CCc2ccccc2)[C@@H](O)[C@@H](Cc2ccccc2)N(C1=O)c1ccc(F)c(c1)C(N)=O |
Structure |
|