| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Histamine H4 receptor |
|---|
| Ligand | BDBM50414378 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_576569 (CHEMBL1034550) |
|---|
| Ki | 100±n/a nM |
|---|
| Citation |  Lim, HD; Istyastono, EP; van de Stolpe, A; Romeo, G; Gobbi, S; Schepers, M; Lahaye, R; Menge, WM; Zuiderveld, OP; Jongejan, A; Smits, RA; Bakker, RA; Haaksma, EE; Leurs, R; de Esch, IJ Clobenpropit analogs as dual activity ligands for the histamine H3 and H4 receptors: synthesis, pharmacological evaluation, and cross-target QSAR studies. Bioorg Med Chem17:3987-94 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Histamine H4 receptor |
|---|
| Name: | Histamine H4 receptor |
|---|
| Synonyms: | AXOR35 | G-protein coupled receptor 105 | GPCR105 | GPRv53 | HH4R | HISTAMINE H4 | HRH4 | HRH4_HUMAN | Histamine H4 receptor | Histamine H4 receptor (H4R) | Histamine receptor (H3 and H4) | Pfi-013 | SP9144 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 44517.02 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Binding assays were using CHO cells stably expressing hH4R receptors. |
|---|
| Residue: | 390 |
|---|
| Sequence: | MPDTNSTINLSLSTRVTLAFFMSLVAFAIMLGNALVILAFVVDKNLRHRSSYFFLNLAIS
DFFVGVISIPLYIPHTLFEWDFGKEICVFWLTTDYLLCTASVYNIVLISYDRYLSVSNAV
SYRTQHTGVLKIVTLMVAVWVLAFLVNGPMILVSESWKDEGSECEPGFFSEWYILAITSF
LEFVIPVILVAYFNMNIYWSLWKRDHLSRCQSHPGLTAVSSNICGHSFRGRLSSRRSLSA
STEVPASFHSERQRRKSSLMFSSRTKMNSNTIASKMGSFSQSDSVALHQREHVELLRARR
LAKSLAILLGVFAVCWAPYSLFTIVLSFYSSATGPKSVWYRIAFWLQWFNSFVNPLLYPL
CHKRFQKAFLKIFCIKKQPLPSQHSRSVSS
|
|
|
|---|
| BDBM50414378 |
|---|
| n/a |
|---|
| Name | BDBM50414378 |
|---|
| Synonyms: | CHEMBL1202320 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H22N4S |
|---|
| Mol. Mass. | 302.438 |
|---|
| SMILES | Cc1ccc(CCN=C(N)SCCCc2cnc[nH]2)cc1 |w:7.6| |
|---|
| Structure | 
|
|---|
Search and Browse
