Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetalpha-1 Nicotinic AChR
LigandBDBM50416397
Substrate/Competitorn/a
Meas. Tech.ChEMBL_643569
IC50 794.33±n/a nM
Citation Capelli AMCastelletti LSalvagno COliosi BDi Lenarda EVirginio CLightfoot AKew JNTeague S Identification of novel alpha7 nAChR positive allosteric modulators with the use of pharmacophore in silico screening methods. Bioorg Med Chem Lett 20:4561-5 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
alpha-1 Nicotinic AChR
Name:Nicotinic acetylcholine receptor alpha-1/beta-1/delta/epsilon
Synonyms:Acetylcholine receptor protein alpha chain | Acetylcholine receptor subunit alpha | Cholinergic, Nicotinic Alpha1Beta1DeltaGamma | Cholinergic, Nicotinic Alpha1Beta2 | Nicotinic acetylcholine receptor alpha2/beta4 | n-AChR
Type:Ion channel
Mol. Mass.:54542.01
Organism:Homo sapiens (Human)
Description:n/a
Residue:482
Sequence:
MEPWPLLLLFSLCSAGLVLGSEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQL
INVDEVNQIVTTNVRLKQGDMVDLPRPSCVTLGVPLFSHLQNEQWVDYNLKWNPDDYGGV
KKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHF
PFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPD
TPYLDITYHFVMQRLPLYFIVNVIIPCLLFSFLTGLVFYLPTDSGEKMTLSISVLLSLTV
FLLVIVELIPSTSSAVPLIGKYMLFTMVFVIASIIITVIVINTHHRSPSTHVMPNWVRKV
FIDTIPNIMFFSTMKRPSREKQDKKIFTEDIDISDISGKPGPPPMGFHSPLIKHPEVKSA
IEGIKYIAETMKSDQESNNAAAEWKYVAMVMDHILLGVFMLVCIIGTLAVFAGRLIELNQ
QG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50416397
n/a
NameBDBM50416397
Synonyms:CHEMBL1210515
TypeSmall organic molecule
Emp. Form.C26H29N3O3
Mol. Mass.431.5268
SMILESO=C(Cn1nc(cc(Cc2ccco2)c1=O)C1CCCCC1)NC1Cc2ccccc2C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: