Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 1B
LigandBDBM50417427
Substrate/Competitorn/a
Meas. Tech.ChEMBL_686386
Ki 0.794±n/a nM
Citation Bromidge SMArban RBertani BBorriello MCapelli AMDi-Fabio RFaedo SGianotti MGordon LJGranci EPasquarello ASpada SKWorby AZonzini LZucchelli V 5-{2-[4-(2-methyl-5-quinolinyl)-1-piperazinyl]ethyl}-2(1H)-quinolinones and 3,4-dihydro-2(1H)-quinolinones: dual-acting 5-HT1 receptor antagonists and serotonin reuptake inhibitors. Part 3. Bioorg Med Chem Lett 20:7092-6 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5-hydroxytryptamine receptor 1B
Name:Serotonin (5-HT) receptor
Synonyms:5-HT-1B | 5-HT-1D-beta | 5-HT1B | 5-hydroxytryptamine receptor 1B (5-HT1B) | S12 | Serotonin 1D beta receptor | Serotonin Receptor 1B
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:43579.17
Organism:Homo sapiens (Human)
Description:Receptor binding assays were performed using human clone stably expressed in CHO cells
Residue:390
Sequence:
MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKVLLVMLLALIT
LATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQV
VCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISI
SLPPFFWRQAKAEEEVSECVVNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRIL
KQTPNRTGKRLTRAQLITDSPGSTSSVTSINSRVPDVPSESGSPVYVNQVKVRVSDALLE
KKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYL
NSLINPIIYTMSNEDFKQAFHKLIRFKCTS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50417427
n/a
NameBDBM50417427
Synonyms:CHEMBL1290716
TypeSmall organic molecule
Emp. Form.C26H28N4O
Mol. Mass.412.5267
SMILESCc1ccc2c(cccc2n1)N1CCN(CCc2cccc3n(C)c(=O)ccc23)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: