Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome P450 2E1
LigandBDBM50240850
Substrate/Competitorn/a
Meas. Tech.ChEMBL_738342
Ki 9980±n/a nM
Citation Fontana EDansette PMPoli SM Cytochrome p450 enzymes mechanism based inhibitors: common sub-structures and reactivity. Curr Drug Metab 6:413-54 (2005) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Cytochrome P450 2E1
Name:Cytochrome P450 2E1
Synonyms:Cytochrome P450 2E1 (CYP2E1)
Type:Enzyme
Mol. Mass.:56860.34
Organism:Homo sapiens (Human)
Description:P05181
Residue:493
Sequence:
MSALGVTVALLVWAAFLLLVSMWRQVHSSWNLPPGPFPLPIIGNLFQLELKNIPKSFTRL
AQRFGPVFTLYVGSQRMVVMHGYKAVKEALLDYKDEFSGRGDLPAFHAHRDRGIIFNNGP
TWKDIRRFSLTTLRNYGMGKQGNESRIQREAHFLLEALRKTQGQPFDPTFLIGCAPCNVI
ADILFRKHFDYNDEKFLRLMYLFNENFHLLSTPWLQLYNNFPSFLHYLPGSHRKVIKNVA
EVKEYVSERVKEHHQSLDPNCPRDLTDCLLVEMEKEKHSAERLYTMDGITVTVADLFFAG
TETTSTTLRYGLLILMKYPEIEEKLHEEIDRVIGPSRIPAIKDRQEMPYMDAVVHEIQRF
ITLVPSNLPHEATRDTIFRGYLIPKGTVVVPTLDSVLYDNQEFPDPEKFKPEHFLNENGK
FKYSDYFKPFSTGKRVCAGEGLARMELFLLLCAILQHFNLKPLVDPKDIDLSPIHIGFGC
IPPRYKLCVIPRS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50240850
n/a
NameBDBM50240850
Synonyms:(2-Isothiocyanato-ethyl)-benzene | CHEMBL151649 | Phenethyl isothiocyanate | phenethylisothiocyanate | phenylethyl isothiocyanate
TypeSmall organic molecule
Emp. Form.C9H9NS
Mol. Mass.163.239
SMILESS=C=NCCc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: