| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial |
|---|
| Ligand | BDBM50190556 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_758853 (CHEMBL1810457) |
|---|
| Ki | 1400±n/a nM |
|---|
| Citation |  Recio, E; Musso-Buendía, A; Vidal, AE; Ruda, GF; Kasinathan, G; Nguyen, C; Ruiz-Pérez, LM; Gilbert, IH; González-Pacanowska, D Site-directed mutagenesis provides insights into the selective binding of trityl derivatives to Plasmodium falciparum dUTPase. Eur J Med Chem46:3309-14 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial |
|---|
| Name: | Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial |
|---|
| Synonyms: | DUT | DUT_HUMAN | Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) | Deoxyuridine triphosphatase (dUTPase) | dUTP pyrophosphatase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 26574.03 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P33316 |
|---|
| Residue: | 252 |
|---|
| Sequence: | MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSA
GRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLS
EHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKH
FIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTE
RGSGGFGSTGKN
|
|
|
|---|
| BDBM50190556 |
|---|
| n/a |
|---|
| Name | BDBM50190556 |
|---|
| Synonyms: | 1-(3-tritylaminopropyl)uracil | CHEMBL211905 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H25N3O2 |
|---|
| Mol. Mass. | 411.4956 |
|---|
| SMILES | O=c1ccn(CCCNC(c2ccccc2)(c2ccccc2)c2ccccc2)c(=O)[nH]1 |
|---|
| Structure | 
|
|---|
Search and Browse
