new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin 1d (5-HT1d) receptor
LigandBDBM10755
Substrate/Competitorn/a
Meas. Tech.ChEBML_1963
IC50 10.0±n/a nM
Citation Castro JLMatassa VGBroughton HBMosley RTStreet LJBaker R Synthesis, biological activity and electrostatic properties of 3-[2-(dimethylamino)ethyl]-5-[(3-amino-1,2,4-thiadiazol-5-yl)methyl]-1H-indole, a novel 5-HT1D receptor agonist. Bioorg Med Chem Lett 3:993-997 (1993)    Article
More Info.:Get all data from this article,  Assay Method
 
Serotonin 1d (5-HT1d) receptor
Name:Serotonin 1d (5-HT1d) receptor
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:32680.56
Organism:Sus scrofa
Description:ChEMBL_1963
Residue:291
Sequence:
AMTDLLVSILVMPISIPYTITQTWSFGQLLCDIWLSSDITCCTASILHLCVIALDRYWAI
TDALEYSKRRTAGHAAAMIAIVWAISICISIPPLFWRQARAHEEISDCLVNTSQISYTIY
STCGAFYIPSLLLIILYGRIYRAARNRILNPPSLYGKRFTTAHLITGSAGSSLCSLNPSL
HEGHSHSAGSPLFFNHVKIKLADSVLERKRISAARERKATKTLGIILGAFIICWLPFFVA
SLVLPICRDSCWIHPALFDFFTWLGYLNSLINPIIYTVFNEEFRQAFQKVV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10755
n/a
NameBDBM10755
Synonyms:14C-5-hydroxy tryptamine creatinine disulfate | 2-imino-1-methylimidazolidin-4-one; 3-(2-aminoethyl)-1H-indol-5-ol; bis(sulfuric acid) | 5-HT | 5-Hydroxy Tryptamine | 5-hydroxy tryptamine creatinine disulfate | CHEMBL535832 | Serotonin | [3H]-5-HT
TypeSmall organic molecule
Emp. Form.C10H12N2O
Mol. Mass.176.2151
SMILESNCCc1c[nH]c2ccc(O)cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: