Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetXanthine dehydrogenase/oxidase
LigandBDBM35440
Substrate/Competitorn/a
Meas. Tech.ChEMBL_935552
IC50 6000±n/a nM
Citation Mandawad GGDawane BSBeedkar SDKhobragade CNYemul OS Trisubstituted thiophene analogues of 1-thiazolyl-2-pyrazoline, super oxidase inhibitors and free radical scavengers. Bioorg Med Chem 21:365-72 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Xanthine dehydrogenase/oxidase
Name:Xanthine dehydrogenase/oxidase
Synonyms:XD | XO | Xanthine dehydrogenase | Xanthine oxidase | Xanthine oxidoreductase
Type:PROTEIN
Mol. Mass.:146252.77
Organism:Rattus norvegicus
Description:ChEMBL_1296864
Residue:1331
Sequence:
MTADELVFFVNGKKVVEKNADPETTLLVYLRRKLGLCGTKLGCGEGGCGACTVMISKYDR
LQNKIVHFSVNACLAPICSLHHVAVTTVEGIGNTQKLHPVQERIARSHGSQCGFCTPGIV
MSMYTLLRNQPEPTVEEIENAFQGNLCRCTGYRPILQGFRTFAKDGGCCGGSGNNPNCCM
NQTKDQTVSLSPSLFNPEDFKPLDPTQEPIFPPELLRLKDTPQKKLRFEGERVTWIQAST
MEELLDLKAQHPDAKLVVGNTEIGIEMKFKNMLFPLIVCPAWIPELNSVVHGPEGISFGA
SCPLSLVESVLAEEIAKLPEQKTEVFRGVMEQLRWFAGKQVKSVASIGGNIITASPISDL
NPVFMASGAKLTLVSRGTRRTVRMDHTFFPGYRKTLLRPEEILLSIEIPYSKEGEFFSAF
KQASRREDDIAKVTSGMRVLFKPGTIEVQELSLCFGGMADRTISALKTTPKQLSKSWNEE
LLQSVCAGLAEELQLAPDAPGGMVEFRRTLTLSFFFKFYLTVLQKLGRADLEDMCGKLDP
TFASATLLFQKDPPANVQLFQEVPKDQSEEDMVGRPLPHLAANMQASGEAVYCDDIPRYE
NELSLRLVTSTRAHAKITSIDTSEAKKVPGFVCFLTAEDVPNSNATGLFNDETVFAKDEV
TCVGHIIGAVVADTPEHAQRAARGVKITYEDLPAIITIQDAINNNSFYGSEIKIEKGDLK
KGFSEADNVVSGELYIGGQEHFYLETNCTIAVPKGEAGEMELFVSTQNTMKTQSFVAKML
GVPDNRIVVRVKRMGGGFGGKETRSTVVSTALALAAHKTGRPVRCMLDRDEDMLITGGRH
PFLAKYKVGFMKTGTVVALEVAHFSNGGNTEDLSRSIMERALFHMDNAYKIPNIRGTGRI
CKTNLPSNTAFRGFGGPQGMLIAEYWMSEVAITCGLPAEEVRRKNMYKEGDLTHFNQKLE
GFTLPRCWDECIASSQYLARKREVEKFNRENCWKKRGLCIIPTKFGISFTLPFLNQGGAL
VHVYTDGSVLLTHGGTEMGQGLHTKMVQVASRALKIPTSKIHISETSTNTVPNTSPTAAS
ASADLNGQGVYEACQTILKRLEPFKKKKPTGPWEAWVMDAYTSAVSLSATGFYKTPNLGY
SFETNSGNPFHYFSYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAFV
QGLGLFTMEELHYSPEGSLHTRGPSTYKIPAFGSIPIEFRVSLLRDCPNKRAIYASKAVG
EPPLFLASSIFFAIKDAIRAARAQHGDNAKQLFQLDSPATPEKIRNACVDQFTTLCVTGV
PENCKSWSVRI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM35440
n/a
NameBDBM35440
Synonyms:ALLOPURINOL | MLS000069453 | SMR000059083 | cid_2094
TypeSmall organic molecule
Emp. Form.C5H4N4O
Mol. Mass.136.1115
SMILESO=c1[nH]cnc2n[nH]cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: