| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Proteasome subunit beta type-5 |
|---|
| Ligand | BDBM50426992 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_939307 (CHEMBL2327272) |
|---|
| IC50 | 2800±n/a nM |
|---|
| Citation |  Geurink, PP; van der Linden, WA; Mirabella, AC; Gallastegui, N; de Bruin, G; Blom, AE; Voges, MJ; Mock, ED; Florea, BI; van der Marel, GA; Driessen, C; van der Stelt, M; Groll, M; Overkleeft, HS; Kisselev, AF Incorporation of non-natural amino acids improves cell permeability and potency of specific inhibitors of proteasome trypsin-like sites. J Med Chem56:1262-75 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Proteasome subunit beta type-5 |
|---|
| Name: | Proteasome subunit beta type-5 |
|---|
| Synonyms: | 20S proteasome chymotrypsin-like | 26S proteosome | LMPX | MB1 | PSB5_HUMAN | PSMB5 | Proteasome Macropain subunit MB1 | Proteasome subunit beta type-1/beta type-5 | X |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 28480.96 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 263 |
|---|
| Sequence: | MALASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGT
TTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLAR
QCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRI
SGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVRE
DGWIRVSSDNVADLHEKYSGSTP
|
|
|
|---|
| BDBM50426992 |
|---|
| n/a |
|---|
| Name | BDBM50426992 |
|---|
| Synonyms: | CHEMBL2326260 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C36H46N8O5S |
|---|
| Mol. Mass. | 702.866 |
|---|
| SMILES | CC(C)C[C@H](NC(=O)[C@H](Cc1ccc(N)cc1)NC(=O)[C@H](Cc1ccccc1)N=[N+]=[N-])C(=O)N[C@@H](Cc1ccc(CN)cc1)\C=C\S(C)(=O)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
