Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeripheral-Type Benzodiazepine Receptor
LigandBDBM50430878
Substrate/Competitorn/a
Meas. Tech.ChEMBL_945907
Ki 0.27±n/a nM
Citation Tang DMcKinley ETHight MRUddin MIHarp JMFu ANickels MLBuck JRManning HC Synthesis and structure-activity relationships of 5,6,7-substituted pyrazolopyrimidines: discovery of a novel TSPO PET ligand for cancer imaging. J Med Chem 56:3429-33 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Peripheral-Type Benzodiazepine Receptor
Name:Benzodiazepine receptors; peripheral & central
Synonyms:Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR)
Type:Mitochondrion membrane protein
Mol. Mass.:18945.84
Organism:Rattus norvegicus (rat)
Description:Competitive binding experiments were performed on rat kidney mitochondrial membranes.
Residue:169
Sequence:
MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50430878
n/a
NameBDBM50430878
Synonyms:CHEMBL2336474
TypeSmall organic molecule
Emp. Form.C24H31FN4O2
Mol. Mass.426.5269
SMILESCCN(CC)C(=O)Cc1c(nn2c(CC)cc(CC)nc12)-c1ccc(OCCF)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: