Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50432553 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_950474 (CHEMBL2351226) |
---|
Ki | 53±n/a nM |
---|
Citation | Li, Y; Wang, X; Zhang, J; Deuther-Conrad, W; Xie, F; Zhang, X; Liu, J; Qiao, J; Cui, M; Steinbach, J; Brust, P; Liu, B; Jia, H Synthesis and evaluation of novel (18)F-labeled spirocyclic piperidine derivatives ass1 receptor ligands for positron emission tomography imaging. J Med Chem56:3478-91 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25266.54 |
Organism: | RAT |
Description: | Q9R0C9 |
Residue: | 223 |
Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
BDBM50432553 |
---|
n/a |
---|
Name | BDBM50432553 |
Synonyms: | CHEMBL2346999 |
Type | Small organic molecule |
Emp. Form. | C23H28FNO3 |
Mol. Mass. | 385.4717 |
SMILES | FCCOCCOc1ccc(CN2CCC3(CC2)OCc2ccccc32)cc1 |
Structure |
|