| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50058020 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_949952 (CHEMBL2352307) |
|---|
| Ki | 0.670000±n/a nM |
|---|
| Citation |  Li, Y; Wang, X; Zhang, J; Deuther-Conrad, W; Xie, F; Zhang, X; Liu, J; Qiao, J; Cui, M; Steinbach, J; Brust, P; Liu, B; Jia, H Synthesis and evaluation of novel (18)F-labeled spirocyclic piperidine derivatives ass1 receptor ligands for positron emission tomography imaging. J Med Chem56:3478-91 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25124.85 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q99720 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM50058020 |
|---|
| n/a |
|---|
| Name | BDBM50058020 |
|---|
| Synonyms: | 4-[1-((E)-3-Iodo-allyl)-piperidin-4-ylmethoxy]-benzonitrile | CHEMBL2347004 | CHEMBL274585 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H19IN2O |
|---|
| Mol. Mass. | 382.2393 |
|---|
| SMILES | I\C=C\CN1CCC(COc2ccc(cc2)C#N)CC1 |
|---|
| Structure | 
|
|---|
Search and Browse
