Reaction Details |
| Report a problem with these data |
Target | Peptidyl-prolyl cis-trans isomerase FKBP1A |
---|
Ligand | BDBM50432738 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_952909 (CHEMBL2351898) |
---|
Ki | 2800±n/a nM |
---|
Citation | Wang, Y; Kirschner, A; Fabian, AK; Gopalakrishnan, R; Kress, C; Hoogeland, B; Koch, U; Kozany, C; Bracher, A; Hausch, F Increasing the efficiency of ligands for FK506-binding protein 51 by conformational control. J Med Chem56:3922-35 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Peptidyl-prolyl cis-trans isomerase FKBP1A |
---|
Name: | Peptidyl-prolyl cis-trans isomerase FKBP1A |
Synonyms: | 12 kDa FK506-binding protein | 12 kDa FKBP | FK506-binding protein 1A | FK506-binding protein 1A (FKBP12) | FKB1A_HUMAN | FKBP-12 | FKBP-1A | FKBP1 | FKBP12 | FKBP1A | Immunophilin FKBP12 | PPIase | PPIase FKBP1A | Peptidyl-prolyl cis-trans isomerase (FKBP) | Rotamase | RyR1/FKBP12 | mTOR/FKBP12A/FKBP12B |
Type: | Isomerase |
Mol. Mass.: | 11953.09 |
Organism: | Homo sapiens (Human) |
Description: | P62942 |
Residue: | 108 |
Sequence: | MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGW
EEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
|
|
|
BDBM50432738 |
---|
n/a |
---|
Name | BDBM50432738 |
Synonyms: | CHEMBL2348605 |
Type | Small organic molecule |
Emp. Form. | C28H38N2O5 |
Mol. Mass. | 482.6117 |
SMILES | COc1cc2CCN3C(=O)[C@@H]4CCCC(N4C(=O)C(=O)[C@]4(C)CCCC[C@H]4C)[C@@]3(C)c2c(OC)c1 |r,TLB:16:15:13.12.11:28.7.8| |
Structure |
|