Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLipoprotein lipase
LigandBDBM50433472
Substrate/Competitorn/a
Meas. Tech.ChEMBL_959456
IC50 1690±n/a nM
Citation Greco MNConnelly MALeo GCOlson MWPowell EHuang ZHawkins MSmith CSchalk-Hihi CDarrow ALXin HLang WDamiano BPHlasta DJ A thiocarbamate inhibitor of endothelial lipase raises HDL cholesterol levels in mice. Bioorg Med Chem Lett 23:2595-7 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lipoprotein lipase
Name:Lipoprotein lipase
Synonyms:LPL
Type:PROTEIN
Mol. Mass.:53173.96
Organism:Homo sapiens (Human)
Description:ChEMBL_1280894
Residue:475
Sequence:
MESKALLVLTLAVWLQSLTASRGGVAAADQRRDFIDIESKFALRTPEDTAEDTCHLIPGV
AESVATCHFNHSSKTFMVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLSRAQEH
YPVSAGYTKLVGQDVARFINWMEEEFNYPLDNVHLLGYSLGAHAAGIAGSLTNKKVNRIT
GLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTFQ
PGCNIGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCSSKEAFEKG
LCLSCRKNRCNNLGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTESETHTNQ
AFEISLYGTVAESENIPFTLPEVSTNKTYSFLIYTEVDIGELLMLKLKWKSDSYFSWSDW
WSSPGFAIQKIRVKAGETQKKVIFCSREKVSHLQKGKAPAVFVKCHDKSLNKKSG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50433472
n/a
NameBDBM50433472
Synonyms:CHEMBL2381069
TypeSmall organic molecule
Emp. Form.C20H24FNOS
Mol. Mass.345.474
SMILESFc1ccccc1CSC(=O)NCCCCCCc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: