Reaction Details |
| Report a problem with these data |
Target | Prostaglandin E synthase |
---|
Ligand | BDBM50435045 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_964545 (CHEMBL2393812) |
---|
IC50 | 133±n/a nM |
---|
Citation | Arhancet, GB; Walker, DP; Metz, S; Fobian, YM; Heasley, SE; Carter, JS; Springer, JR; Jones, DE; Hayes, MJ; Shaffer, AF; Jerome, GM; Baratta, MT; Zweifel, B; Moore, WM; Masferrer, JL; Vazquez, ML Discovery and SAR of PF-4693627, a potent, selective and orally bioavailable mPGES-1 inhibitor for the potential treatment of inflammation. Bioorg Med Chem Lett23:1114-9 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Prostaglandin E synthase |
---|
Name: | Prostaglandin E synthase |
Synonyms: | MGST1L1 | MPGES1 | PGES | PIG12 | PTGES | PTGES_HUMAN | Prostaglandin E synthase (PGES-1) | Prostaglandin E synthase 1 (mPGES-1) | Prostaglandin E synthase-1 (PGES-1) | Prostaglandin E synthase/G/H synthase 2 | Prostaglandin E2 synthase-1 ( mPGES-1) |
Type: | Protein |
Mol. Mass.: | 17112.22 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 152 |
Sequence: | MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCR
SDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGK
LRAPIRSVTYTLAQLPCASMALQILWEAARHL
|
|
|
BDBM50435045 |
---|
n/a |
---|
Name | BDBM50435045 |
Synonyms: | CHEMBL2391141 |
Type | Small organic molecule |
Emp. Form. | C28H34ClN3O4 |
Mol. Mass. | 512.04 |
SMILES | CCOc1ccc(cc1)-c1cc2oc(nc2cc1Cl)N1CCC(CC1)C(=O)N[C@H]1CCC[C@H](CO)C1 |r| |
Structure |
|