Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBradykinin B1 receptor
LigandBDBM50156454
Substrate/Competitorn/a
Meas. Tech.ChEMBL_965477
IC50 0.870000±n/a nM
Citation Germain ARCarmody LCNag PPMorgan BVerplank LFernandez CDonckele EFeng YPerez JRDandapani SPalmer MLander ESGupta PBSchreiber SLMunoz B Cinnamides as selective small-molecule inhibitors of a cellular model of breast cancer stem cells. Bioorg Med Chem Lett 23:1834-8 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Bradykinin B1 receptor
Name:Bradykinin B1 receptor
Synonyms:B1 BRADYKININ | B1 bradykinin receptor | B1R | BK-1 receptor
Type:Enzyme
Mol. Mass.:40508.87
Organism:Homo sapiens (Human)
Description:P46663
Residue:353
Sequence:
MASSWPPLELQSSNQSQLFPQNATACDNAPEAWDLLHRVLPTFIISICFFGLLGNLFVLL
VFLLPRRQLNVAEIYLANLAASDLVFVLGLPFWAENIWNQFNWPFGALLCRVINGVIKAN
LFISIFLVVAISQDRYRVLVHPMASRRQQRRRQARVTCVLIWVVGGLLSIPTFLLRSIQA
VPDLNITACILLLPHEAWHFARIVELNILGFLLPLAAIVFFNYHILASLRTREEVSRTRC
GGRKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQAVRGCFWEDFIDLGLQLANFF
AFTNSSLNPVIYVFVGRLFRTKVWELYKQCTPKSLAPISSSHRKEIFQLFWRN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50156454
n/a
NameBDBM50156454
Synonyms:CHEMBL264100 | des-Arg10-Kallidin
TypeSmall organic molecule
Emp. Form.C50H73N13O11
Mol. Mass.1032.1951
SMILESNCCCC[C@H](N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CO)C(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1ccccc1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: