| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Carbonic anhydrase |
|---|
| Ligand | BDBM26990 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_972118 (CHEMBL2406401) |
|---|
| Ki | 50000±n/a nM |
|---|
| Citation |  Del Prete, S; Vullo, D; De Luca, V; Carginale, V; Scozzafava, A; Supuran, CT; Capasso, C A highly catalytically activeż-carbonic anhydrase from the pathogenic anaerobe Porphyromonas gingivalis and its inhibition profile with anions and small molecules. Bioorg Med Chem Lett23:4067-71 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Carbonic anhydrase |
|---|
| Name: | Carbonic anhydrase |
|---|
| Synonyms: | CAH_METTT | CAM | Carbonic anhydrase | Gamma-carbonic anhydrase |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 26390.56 |
|---|
| Organism: | Methanosarcina thermophila |
|---|
| Description: | P40881 |
|---|
| Residue: | 247 |
|---|
| Sequence: | MMFNKQIFTILILSLSLALAGSGCISEGAEDNVAQEITVDEFSNIRENPVTPWNPEPSAP
VIDPTAYIDPQASVIGEVTIGANVMVSPMASIRSDEGMPIFVGDRSNVQDGVVLHALETI
NEEGEPIEDNIVEVDGKEYAVYIGNNVSLAHQSQVHGPAAVGDDTFIGMQAFVFKSKVGN
NCVLEPRSAAIGVTIPDGRYIPAGMVVTSQAEADKLPEVTDDYAYSHTNEAVVYVNVHLA
EGYKETS
|
|
|
|---|
| BDBM26990 |
|---|
| n/a |
|---|
| Name | BDBM26990 |
|---|
| Synonyms: | CHEMBL1644699 | HS anion | HS(-1) | hydrogen(sulfide)(-1) | hydrosulfide | sulfanide |
|---|
| Type | Ion |
|---|
| Emp. Form. | HS |
|---|
| Mol. Mass. | 33.073 |
|---|
| SMILES | [SH-] |
|---|
| Structure | 
|
|---|
Search and Browse
