| Reaction Details |
|---|
 | Report a problem with these data |
| Target | G-protein coupled bile acid receptor 1 |
|---|
| Ligand | BDBM50437888 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_974031 (CHEMBL2410509) |
|---|
| EC50 | 1500±n/a nM |
|---|
| Citation |  Dehmlow, H; Alvarez Sánchez, R; Bachmann, S; Bissantz, C; Bliss, F; Conde-Knape, K; Graf, M; Martin, RE; Obst Sander, U; Raab, S; Richter, HG; Sewing, S; Sprecher, U; Ullmer, C; Mattei, P Discovery and optimisation of 1-hydroxyimino-3,3-diphenylpropanes, a new class of orally active GPBAR1 (TGR5) agonists. Bioorg Med Chem Lett23:4627-32 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| G-protein coupled bile acid receptor 1 |
|---|
| Name: | G-protein coupled bile acid receptor 1 |
|---|
| Synonyms: | GPBAR_MOUSE | Gpbar1 | M-BAR | Membrane-type receptor for bile acids | Tgr5 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 35665.78 |
|---|
| Organism: | Mus musculus |
|---|
| Description: | ChEMBL_1475560 |
|---|
| Residue: | 329 |
|---|
| Sequence: | MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAG
LLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPH
GSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGAT
ALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYV
ATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRV
LRGRAKRDNPGPSTAYHTSSQCSIDLDLN
|
|
|
|---|
| BDBM50437888 |
|---|
| n/a |
|---|
| Name | BDBM50437888 |
|---|
| Synonyms: | CHEMBL2407945 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H25N3O |
|---|
| Mol. Mass. | 359.4641 |
|---|
| SMILES | CN(C)c1ccc(cc1)C(CC(N=O)c1ccncc1)c1cccc(C)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
