| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50438437 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_975943 (CHEMBL2415592) |
|---|
| IC50 | 21000±n/a nM |
|---|
| Citation |  Hassan, GS; El-Messery, SM; Al-Omary, FA; Al-Rashood, ST; Shabayek, MI; Abulfadl, YS; Habib, el-SE; El-Hallouty, SM; Fayad, W; Mohamed, KM; El-Menshawi, BS; El-Subbagh, HI Nonclassical antifolates, part 4. 5-(2-aminothiazol-4-yl)-4-phenyl-4H-1,2,4-triazole-3-thiols as a new class of DHFR inhibitors: synthesis, biological evaluation and molecular modeling study. Eur J Med Chem66:135-45 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DHFR | DYR_BOVIN | Dihydrofolate reductase | Dihydrofolate reductase (DHFR) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 21603.71 |
|---|
| Organism: | Bos taurus (Cattle) |
|---|
| Description: | P00376 |
|---|
| Residue: | 187 |
|---|
| Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFQYFQRMTTVSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPKGAHFLAKSLDDALELIEDPELTNKVDVVWIVGGSS
VYKEAMNKPGHVRLFVTRIMQEFESDAFFPEIDFEKYKLLPEYPGVPLDVQEEKGIKYKF
EVYEKNN
|
|
|
|---|
| BDBM50438437 |
|---|
| n/a |
|---|
| Name | BDBM50438437 |
|---|
| Synonyms: | CHEMBL2414376 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C12H11N5OS2 |
|---|
| Mol. Mass. | 305.379 |
|---|
| SMILES | COc1ccc(cc1)-n1c(n[nH]c1=S)-c1csc(N)n1 |
|---|
| Structure | 
|
|---|
Search and Browse
