Reaction Details |
| Report a problem with these data |
Target | Hypoxanthine-guanine phosphoribosyltransferase |
---|
Ligand | BDBM50438468 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_976205 (CHEMBL2415854) |
---|
Ki | >10000±n/a nM |
---|
Citation | Clinch, K; Crump, DR; Evans, GB; Hazleton, KZ; Mason, JM; Schramm, VL; Tyler, PC Acyclic phosph(on)ate inhibitors of Plasmodium falciparum hypoxanthine-guanine-xanthine phosphoribosyltransferase. Bioorg Med Chem21:5629-46 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Hypoxanthine-guanine phosphoribosyltransferase |
---|
Name: | Hypoxanthine-guanine phosphoribosyltransferase |
Synonyms: | HGPRT | HGPRTase | HPRT | HPRT1 | HPRT_HUMAN | Hypoxanthine-guanine phosphoribosyltransferase | Hypoxanthine-guanine phosphoribosyltransferase (HGPRT) |
Type: | Protein |
Mol. Mass.: | 24579.61 |
Organism: | Homo sapiens (Human) |
Description: | P00492 |
Residue: | 218 |
Sequence: | MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGH
HIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGD
DLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVG
FEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
|
|
|
BDBM50438468 |
---|
n/a |
---|
Name | BDBM50438468 |
Synonyms: | CHEMBL2414628 |
Type | Small organic molecule |
Emp. Form. | C11H17N4O7P |
Mol. Mass. | 348.249 |
SMILES | OC[C@@H](NCc1c[nH]c2c1nc[nH]c2=O)[C@H](O)COP(O)(O)=O |r| |
Structure |
|