Reaction Details |
| Report a problem with these data |
Target | P2Y purinoceptor 12 |
---|
Ligand | BDBM50439280 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_977531 (CHEMBL2423148) |
---|
IC50 | 23±n/a nM |
---|
Citation | Bach, P; Antonsson, T; Bylund, R; Björkman, JA; Österlund, K; Giordanetto, F; van Giezen, JJ; Andersen, SM; Zachrisson, H; Zetterberg, F Lead optimization of ethyl 6-aminonicotinate acyl sulfonamides as antagonists of the P2Y12 receptor. separation of the antithrombotic effect and bleeding for candidate drug AZD1283. J Med Chem56:7015-24 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
P2Y purinoceptor 12 |
---|
Name: | P2Y purinoceptor 12 |
Synonyms: | ADP-glucose receptor | ADPG-R | HORK3 | P2RY12 | P2T(AC) | P2Y purinoceptor 12 | P2Y(AC) | P2Y(ADP) | P2Y(cyc) | P2Y12 | P2Y12 platelet ADP receptor | P2Y12_HUMAN | Purinergic receptor P2Y12 | SP1999 |
Type: | Enzyme |
Mol. Mass.: | 39458.48 |
Organism: | Homo sapiens (Human) |
Description: | Q9H244 |
Residue: | 342 |
Sequence: | MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFI
IFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITI
DRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKS
EFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFI
IIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFF
LCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM
|
|
|
BDBM50439280 |
---|
n/a |
---|
Name | BDBM50439280 |
Synonyms: | CHEMBL2419485 |
Type | Small organic molecule |
Emp. Form. | C21H21ClN4O5S |
Mol. Mass. | 476.933 |
SMILES | CCOC(=O)c1cc(C#N)c(nc1C)N1CC(C1)C(=O)NS(=O)(=O)Cc1ccc(Cl)cc1 |
Structure |
|