Reaction Details |
| Report a problem with these data |
Target | Hypoxanthine-guanine phosphoribosyltransferase |
---|
Ligand | BDBM50439832 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_978181 (CHEMBL2423189) |
---|
Ki | 5400±n/a nM |
---|
Citation | Baszczynski, O; Hocková, D; Janeba, Z; Holý, A; Jansa, P; Dracínský, M; Keough, DT; Guddat, LW The effect of novel [3-fluoro-(2-phosphonoethoxy)propyl]purines on the inhibition of Plasmodium falciparum, Plasmodium vivax and human hypoxanthine-guanine-(xanthine) phosphoribosyltransferases. Eur J Med Chem67:81-9 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Hypoxanthine-guanine phosphoribosyltransferase |
---|
Name: | Hypoxanthine-guanine phosphoribosyltransferase |
Synonyms: | HGPRT | HGPRTase | HPRT | HPRT1 | HPRT_HUMAN | Hypoxanthine-guanine phosphoribosyltransferase | Hypoxanthine-guanine phosphoribosyltransferase (HGPRT) |
Type: | Protein |
Mol. Mass.: | 24579.61 |
Organism: | Homo sapiens (Human) |
Description: | P00492 |
Residue: | 218 |
Sequence: | MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGH
HIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGD
DLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVG
FEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
|
|
|
BDBM50439832 |
---|
n/a |
---|
Name | BDBM50439832 |
Synonyms: | CHEMBL2420078 |
Type | Small organic molecule |
Emp. Form. | C10H14FN4O5P |
Mol. Mass. | 320.2141 |
SMILES | OP(O)(=O)CCOC(CF)Cn1cnc2c1nc[nH]c2=O |
Structure |
|