Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein-arginine deiminase type-2
LigandBDBM80075
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1290379
IC50 6320±n/a nM
Citation Dreyton CJAnderson EDSubramanian VBoger DLThompson PR Insights into the mechanism of streptonigrin-induced protein arginine deiminase inactivation. Bioorg Med Chem 22:1362-9 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protein-arginine deiminase type-2
Name:Protein-arginine deiminase type-2
Synonyms:PAD-H19 | Peptidylarginine deiminase II | Protein-arginine deiminase type II
Type:PROTEIN
Mol. Mass.:75552.49
Organism:Homo sapiens (Human)
Description:ChEMBL_1290379
Residue:665
Sequence:
MLRERTVRLQYGSRVEAVYVLGTYLWTDVYSAAPAGAQTFSLKHSEHVWVEVVRDGEAEE
VATNGKQRWLLSPSTTLRVTMSQASTEASSDKVTVNYYDEEGSIPIDQAGLFLTAIEISL
DVDADRDGVVEKNNPKKASWTWGPEGQGAILLVNCDRETPWLPKEDCRDEKVYSKEDLKD
MSQMILRTKGPDRLPAGYEIVLYISMSDSDKVGVFYVENPFFGQRYIHILGRRKLYHVVK
YTGGSAELLFFVEGLCFPDEGFSGLVSIHVSLLEYMAQDIPLTPIFTDTVIFRIAPWIMT
PNILPPVSVFVCCMKDNYLFLKEVKNLVEKTNCELKVCFQYLNRGDRWIQDEIEFGYIEA
PHKGFPVVLDSPRDGNLKDFPVKELLGPDFGYVTREPLFESVTSLDSFGNLEVSPPVTVN
GKTYPLGRILIGSSFPLSGGRRMTKVVRDFLKAQQVQAPVELYSDWLTVGHVDEFMSFVP
IPGTKKFLLLMASTSACYKLFREKQKDGHGEAIMFKGLGGMSSKRITINKILSNESLVQE
NLYFQRCLDWNRDILKKELGLTEQDIIDLPALFKMDEDHRARAFFPNMVNMIVLDKDLGI
PKPFGPQVEEECCLEMHVRGLLEPLGLECTFIDDISAYHKFLGEVHCGTNVRRKPFTFKW
WHMVP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM80075
n/a
NameBDBM80075
Synonyms:7-bromanyl-6-methoxy-quinoline-5,8-dione | 7-bromo-6-methoxy-quinoline-5,8-quinone | 7-bromo-6-methoxyquinoline-5,8-dione | MLS002703741 | SMR001570458 | cid_265935
TypeSmall organic molecule
Emp. Form.C10H6BrNO3
Mol. Mass.268.064
SMILESCOC1=C(Br)C(=O)c2ncccc2C1=O |c:2|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: