Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone Deacetylase 10 (HDAC10)
LigandBDBM50293361
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1335260
IC50 91000±n/a nM
Citation Cincinelli RMusso LGiannini GZuco VDe Cesare MZunino FDallavalle S Influence of the adamantyl moiety on the activity of biphenylacrylohydroxamic acid-based HDAC inhibitors. Eur J Med Chem 79:251-9 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histone Deacetylase 10 (HDAC10)
Name:Histone deacetylase
Synonyms:HD10 | Histone deacetylase | Histone deacetylase 10 | Human HDAC10
Type:Chromatin regulator; hydrolase; repressor
Mol. Mass.:71431.89
Organism:Homo sapiens (Human)
Description:Q969S8
Residue:669
Sequence:
MGTALVYHEDMTATRLLWDDPECEIERPERLTAALDRLRQRGLEQRCLRLSAREASEEEL
GLVHSPEYVSLVRETQVLGKEELQALSGQFDAIYFHPSTFHCARLAAGAGLQLVDAVLTG
AVQNGLALVRPPGHHGQRAAANGFCVFNNVAIAAAHAKQKHGLHRILVVDWDVHHGQGIQ
YLFEDDPSVLYFSWHRYEHGRFWPFLRESDADAVGRGQGLGFTVNLPWNQVGMGNADYVA
AFLHLLLPLAFEFDPELVLVSAGFDSAIGDPEGQMQATPECFAHLTQLLQVLAGGRVCAV
LEGGYHLESLAESVCMTVQTLLGDPAPPLSGPMAPCQSALESIQSARAAQAPHWKSLQQQ
DVTAVPMSPSSHSPEGRPPPLLPGGPVCKAAASAPSSLLDQPCLCPAPSVRTAVALTTPD
ITLVLPPDVIQQEASALREETEAWARPHESLAREEALTALGKLLYLLDGMLDGQVNSGIA
ATPASAAAATLDVAVRRGLSHGAQRLLCVALGQLDRPPDLAHDGRSLWLNIRGKEAAALS
MFHVSTPLPVMTGGFLSCILGLVLPLAYGFQPDLVLVALGPGHGLQGPHAALLAAMLRGL
AGGRVLALLEENSTPQLAGILARVLNGEAPPSLGPSSVASPEDVQALMYLRGQLEPQWKM
LQCHPHLVA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50293361
n/a
NameBDBM50293361
Synonyms:CHEMBL561209 | N-Hydroxy-E-3-(4'-methoxybiphenyl-4-yl)-acrylamide
TypeSmall organic molecule
Emp. Form.C16H15NO3
Mol. Mass.269.2952
SMILESCOc1ccc(cc1)-c1ccc(\C=C\C(=O)NO)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: