| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50007903 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1337106 (CHEMBL3239991) |
|---|
| IC50 | 55±n/a nM |
|---|
| Citation |  G-Dayanandan, N; Paulsen, JL; Viswanathan, K; Keshipeddy, S; Lombardo, MN; Zhou, W; Lamb, KM; Sochia, AE; Alverson, JB; Priestley, ND; Wright, DL; Anderson, AC Propargyl-linked antifolates are dual inhibitors of Candida albicans and Candida glabrata. J Med Chem57:2643-56 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DFR1 | DYR_CANAX | Dihydrofolate Reductase (DHFR) | Tetrahydrofolate dehydrogenase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 22141.77 |
|---|
| Organism: | Candida albicans |
|---|
| Description: | C. albicans DHFR was expressed in E. coli BL21, and purified to homogeneity. |
|---|
| Residue: | 192 |
|---|
| Sequence: | MSKPNVAIIVAALKPALGIGYKGKMPWRLRKEIRYFKDVTTRTTKPNTRNAVIMGRKTWE
SIPQKFRPLPDRLNIILSRSYENKIIDDNIIHASSIESSLNLVSDVERVFIIGGAEIYNE
LINNSLVSHLLITEIEHPSPESIEMDTFLKFPLESWTKQPKSELQKFVGDTVLEDDIKEG
DFTYNYTLWTRK
|
|
|
|---|
| BDBM50007903 |
|---|
| n/a |
|---|
| Name | BDBM50007903 |
|---|
| Synonyms: | CHEMBL3234322 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H21N5 |
|---|
| Mol. Mass. | 343.4249 |
|---|
| SMILES | CCc1nc(N)nc(N)c1C#CC(C)c1ccc(nc1)-c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
