Reaction Details |
| Report a problem with these data |
Target | Apelin |
---|
Ligand | BDBM50009575 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1336427 (CHEMBL3242431) |
---|
IC50 | 1.40±n/a nM |
---|
Citation | Margathe, JF; Iturrioz, X; Alvear-Perez, R; Marsol, C; Riché, S; Chabane, H; Tounsi, N; Kuhry, M; Heissler, D; Hibert, M; Llorens-Cortes, C; Bonnet, D Structure-activity relationship studies toward the discovery of selective apelin receptor agonists. J Med Chem57:2908-19 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Apelin |
---|
Name: | Apelin |
Synonyms: | APEL_RAT | APJ endogenous ligand | Apel | Apelin-13 | Apelin-28 | Apelin-31 | Apelin-36 | Apln |
Type: | PROTEIN |
Mol. Mass.: | 8687.84 |
Organism: | Rattus norvegicus |
Description: | ChEMBL_108274 |
Residue: | 77 |
Sequence: | MNLSFCVQALLLLWLSLTAVCGVPLMLPPDGKGLEEGNMRYLVKPRTSRTGPGAWQGGRR
KFRRQRPRLSHKGPMPF
|
|
|
BDBM50009575 |
---|
n/a |
---|
Name | BDBM50009575 |
Synonyms: | CHEMBL3234446 |
Type | Small organic molecule |
Emp. Form. | C96H156N34O20S |
Mol. Mass. | 2138.547 |
SMILES | CSCC[C@H](NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc1cnc[nH]1)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](N)CCCCN)C(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1ccccc1)C(O)=O |r| |
Structure |
|