| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Glandular kallikrein |
|---|
| Ligand | BDBM50041220 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1342913 (CHEMBL3259188) |
|---|
| Ki | 9530±n/a nM |
|---|
| Citation |  Tidwell, RR; Geratz, JD; Dann, O; Volz, G; Zeh, D; Loewe, H Diarylamidine derivatives with one or both of the aryl moieties consisting of an indole or indole-like ring. Inhibitors of arginine-specific esteroproteases. J Med Chem21:613-23 (1978) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Glandular kallikrein |
|---|
| Name: | Glandular kallikrein |
|---|
| Synonyms: | KLK_PIG | Tissue kallikrein |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 26710.38 |
|---|
| Organism: | Sus scrofa |
|---|
| Description: | ChEMBL_108296 |
|---|
| Residue: | 242 |
|---|
| Sequence: | APPIQSRIIGGRECEKNSHPWQVAIYHYSSFQCGGVLVNPKWVLTAAHCKNDNYEVWLGR
HNLFENENTAQFFGVTADFPHPGFNLSLLKHTKADGKDYSHDLMLLRLQSPAKITDAVKV
LELPTQEPELGSTCEASGWGSIEPGPDFEFPDEIQCVQLTLLQNTFCAAHPKVTESMLCA
GYLPGGKDTCMGDSGGPLICNGMWQGITSWGHTPCGSANKPSIYTKLIFYLDWINDTITE
NP
|
|
|
|---|
| BDBM50041220 |
|---|
| n/a |
|---|
| Name | BDBM50041220 |
|---|
| Synonyms: | 1,2-bis(5-amidinobenzofuran-2-yl)ethane | 2-(2-{5-[(E)-amino(imino)methyl]-1-benzofuran-2-yl}ethyl)-1-benzofuran-5-carboximidamide | 2-(2-{5-[(Z)-amino(imino)methyl]-1-benzofuran-2-yl}ethyl)-1-benzofuran-5-carboximidamide | 2-{2-[5-amino(imino)methylbenzo[b]furan-2-yl]ethyl}benzo[b]furan-5-yl-iminomethanamine | CHEMBL279962 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H18N4O2 |
|---|
| Mol. Mass. | 346.3825 |
|---|
| SMILES | NC(=N)c1ccc2oc(CCc3cc4cc(ccc4o3)C(N)=N)cc2c1 |
|---|
| Structure | 
|
|---|
Search and Browse
