| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Adenylate kinase 2, mitochondrial |
|---|
| Ligand | BDBM50010308 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1340550 (CHEMBL3254974) |
|---|
| Ki | 320000±n/a nM |
|---|
| Citation |  Hampton, A; Picker, D Design of species- or isozyme-specific enzyme inhibitors. 3. Species and isozymic differences between mammalian and bacterial adenylate kinases in substituent tolerance in an enzyme-substrate complex. J Med Chem22:1529-32 (1980) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Adenylate kinase 2, mitochondrial |
|---|
| Name: | Adenylate kinase 2, mitochondrial |
|---|
| Synonyms: | 2.7.4.3 | AK 2 | ATP-AMP transphosphorylase 2 | ATP:AMP phosphotransferase | Adenylate kinase 2 | Adenylate kinase 2, mitochondrial | Adenylate monophosphate kinase | Ak2 | KAD2_RAT |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 26380.21 |
|---|
| Organism: | Rattus norvegicus |
|---|
| Description: | n/a |
|---|
| Residue: | 239 |
|---|
| Sequence: | MAPNALAPEPEHPEGIRAVLLGPPGAGKGTQAPKLAENFCVCHLATGDMLRAMVASGSEL
GKKLKATMDAGKLVSDEMVVELIEKNLETPSCKNGFLLDGFPRTVKQAEMLDDLMDKRKE
KLDSVIEFSIQDSLLIRRITGRLIHPKSGRSYHEEFNPPKEAMKDDITGEPLIRRSDDNE
KALKTRLEAYHTQTTPLVEYYRKRGIHCAIDASQTPDVVFASILAAFSKATCKDLVMFV
|
|
|
|---|
| BDBM50010308 |
|---|
| n/a |
|---|
| Name | BDBM50010308 |
|---|
| Synonyms: | CHEMBL3251357 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C11H18N5O13P3S |
|---|
| Mol. Mass. | 553.273 |
|---|
| SMILES | CSc1nc2c(N)ncnc2n1[C@@H]1O[C@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)[C@@H](O)[C@H]1O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
