Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50016261 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1348487 (CHEMBL3266802) |
---|
Ki | 7463±n/a nM |
---|
Citation | Bai, S; Li, S; Xu, J; Peng, X; Sai, K; Chu, W; Tu, Z; Zeng, C; Mach, RH Synthesis and structure-activity relationship studies of conformationally flexible tetrahydroisoquinolinyl triazole carboxamide and triazole substituted benzamide analogues ass2 receptor ligands. J Med Chem57:4239-51 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25124.85 |
Organism: | Homo sapiens (Human) |
Description: | Q99720 |
Residue: | 223 |
Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
BDBM50016261 |
---|
n/a |
---|
Name | BDBM50016261 |
Synonyms: | CHEMBL3262794 |
Type | Small organic molecule |
Emp. Form. | C22H23Cl2NO |
Mol. Mass. | 388.33 |
SMILES | [H][C@@]12C[C@](CCN1C)(CC\C2=C\c1ccc(Cl)c(Cl)c1)c1cccc(O)c1 |r| |
Structure |
|