Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstaglandin E2 receptor EP2 subtype
LigandBDBM85602
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1364380
EC50 33±n/a nM
Citation Ganesh T Prostanoid receptor EP2 as a therapeutic target. J Med Chem 57:4454-65 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Prostaglandin E2 receptor EP2 subtype
Name:Prostaglandin E2 receptor
Synonyms:PGE receptor EP2 subtype | PTGER2 | Prostaglandin E2 | Prostanoid EP2 Receptor
Type:Enzyme
Mol. Mass.:39775.71
Organism:Homo sapiens (Human)
Description:P43116
Residue:358
Sequence:
MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGR
RSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFS
LATMLMLFAMALERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQ
YCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGS
GRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQA
LRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM85602
n/a
NameBDBM85602
Synonyms:(R)-BUTAPROST | Butaprost (Free Acid) | CAS_69648-38-0
TypeSmall organic molecule
Emp. Form.C24H40O5
Mol. Mass.408.5714
SMILESCCCC1(CCC1)[C@H](O)C\C=C\[C@H]1[C@H](O)CC(=O)[C@@H]1CCCCCCC(=O)OC |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: